Insilicase
deus ex computa
     Skip Navigation Links.

 

Protein cleavage

Purpose of this page

This web page is designed to identify the positions of (user supplied) cleavage sites in a protein sequence and then calculate the fragment masses of the resultant peptides. The web page assumes the cleavage site is at the N-terminus of the first amino acid in the cleavage site. This may incorrectly report the mass of a fragment, but this error is probably very small compared to the problems sizing fragments on a SDS-page gel.

insilicase icon A Windows program that duplicates this page can be downloaded here.

Add protein sequence in the box below (maximum length is 5000 residues)

Enter sites if using more than one site separate each site with a comma (maximum of 500 characters).

  

Results

Instructions and sample data

Copy and paste the protein sequence in to the top text box, next enter the list of cleavage sites (separated by a comma) into the middle box (see below for an example list) and finally press the submit button.

Sample list of cleavage site:
VEID,IETD,LEHD,VAD

Sample protein sequence:
MHGGGPPSGDSACPLRTIKRVQFGVLSPDELKRMSVTEGGIKYPETTEGGRPKLGGLMDP VEIDRQGVIERTGRCQTCAGNMTECPGHFGHIELAKPVFHVGFLVKTMKVLRCVCFFCSK LLVDSNNPKIKDILAKSKGQPKKRLTHVYDLCKGKNICEGGEEMLEHDDNKFGVEQPEGD EDLTKEKGHGGCGRYQPRIRRSGLELYAEWKHVNEDSQEKKILLSPERVHEIFKRISDEE CFVLGMEPRYARPEWMIVTVLPVPPLSVRPAVVMQGSARNQDDLTHKLADIVKINNQLRR NEQNGAAAHVIAEDVKLLQFHVATMVDNELPGLPRAMQKSGRPLKSLKQRLKGKEGRVRG NLMGKRVDFSARTVITPDPNLSIDQVGVPRSIAANMTFAEIVTPFNIDRLQELVRRGNSQ YPGAKYIIRDNGDRIDLRFHPKPSDLHLQTGYKVERHMCDGDIVIFNRQPTLHKMSMMGH RVRILPWSTFRLNLSVTTPYNADFDGDEMNLHLPQSLETRAEIQELAMVPRMIVTPQSNR PVMGIVQDTLTAVRKFTKRDVFLERVCGPNGNLA



Copyright © 2011 Insilicase.

 

   
  54.225.47.124